Tuesday, August 25, 2020
Swift Essay Example For Students
Quick Essay Jonathan Swift: Misguided and Incorrect Criticisms Jonathan Swift (1667-1745) is perhaps the best humorist throughout the entire existence of English writing, and is without question the most disputable. Angered by the ethical corruption of society in the eighteenth century, Swift composed a plenty of severe pieces assaulting keeps an eye on exorbitant pride, and the basic gathering has been one of extremely blended audits. While hardly any inquiry Swifts aptitude as a humorist, his savage, barbarous assaults on the weaknesses of humankind have driven more than one pundit to level negative allegations against him. His convictions have prompted charges of sin, an enemy of government disposition and a dedication to liberating keeps an eye on right to enthusiasm. His most well known work, Gullivers Travels, has brought about assaults on his composing style, and his unfeeling, harmful ambushes on wrongdoing have prompted cries of narcissist, skeptic and cruel person. All of these allegat ions is bogus. Jonathan Swifts pundits are confused and erroneous in their assaults on his convictions and compositions. Jonathan Swift is erroneously blamed for apostasy for assaulting human life. Quick enrages a few pundits for censuring something that they feel must be divine since it is the main instrument of God. These pundits contend that human instinct must be noble on the off chance that it is the key topic of Christianity. They, be that as it may, aren't right, and are liable of being gullible. Quick and his supporters counter their assaults by bringing up that it is fraudulent of them to love such indecencies as defilement, ravenousness, and everlasting status, and these pundits need to investigate this (Knowles 34-35). Quick himself has addressed these charges of apostasy, clarifying that he has never been enemy of Christian and just can't help contradicting the idea of unique sin. For a mind-blowing duration and in his compositions, Jonathan Swift has consistently been a passionate man of religion (Tuveson 103, 3). Pundits erroneously guarantee that Jonathan Swift considers God to be excessively incredible for people (Dennis 58). Swifts compositions demonstrate that he has consistently been a firm adherent that solitary God and Christ are equipped for outright good flawlessness, yet he likewise emphatically accepts that man is unquestionably fit for shortening the hole (Tuveson 129). Quick has said that he regularly has no confidence in hypotheses or frameworks, because of the way that they are driven by man and in this manner can't work consummately. Christianity, he feels, is a special case to this standard, in light of the fact that the framework guides man similarly as man controls the framework (Bloom, Swift 15). This conviction likewise counters the claims of apostasy. Jonathan Swift has regularly dishonestly been blamed for being hostile to government. One of Swifts numerous assailants, Leslie Stephen, pounces upon him for following each cur rent wickedness to the impostures and debasements . . . of government (Bloom, Gulliver 33). While parts one, two and three of Gullivers Travels are composed somewhat as assaults on the Whigs, Swift just does so as a result of his devotion with the Tories, a restricting gathering. It is a horrid depiction of authorities, and Swifts supporters trust it is an exact one (Knowles 33-34). It is worked out of an expectation for change, notwithstanding, not of abhor. Quick clarifies that he isn't against government, and he looks downward on radicals and immovably underpins government and set up organizations (Tuveson 5). Quick is an amazingly good man, and could never accept that legislature could be a really good body. All things considered, he feels it can support ethicalness among its kin, regardless of whether that isn't its genuine thought process (Bloom, Swift 14). Quick observes a need for government if man is to ever acknowledge great reasonableness. With the assistance of governmen t, individuals can be pushed toward acceptable sense through guidelines and guidelines and in the long run, in the wake of being compelled to act admirably again and again, have the option to use sound judgment all alone (Tuveson 11). Pundits have guaranteed that Swifts boss objective is to free the universe of enthusiasm. This isn't the situation, as an indifferent society would render Swift unequipped for parody, and he understands this (Ward 6). Quick just needs man to understand that he is comprised of two sections: enthusiasm and great sense (Knowles 36). Quick accepts, as Kathleen Williams calls attention to, that keeps an eye on brain and body are in conflict and should be, beyond what many would consider possible, accommodated. He assaults keeps an eye on multifaceted nature since it keeps him from picking sanely among enthusiasm and great sense and shields him from developing into a healthy, reasonable individual (Bloom, Swift 15). Quick wants to dispose of energy. He just needs man to have some authority over it (Knowles 36). Pundits erroneously contend that quite a bit of Swifts work is basically foolish and excessively innovative (Knowles 36). Gullivers Travels incorporates numerous absurdities, for example, divine beings being scared by young doggies, an envious clergyman and meretricious house cleaners of respect, yet every one of them are incorporated for an explanation (Bloom, Gulliver 43). Quick has embedded every one of these absurdities to demonstrate his hypothesis that man is guileless and oblivious of his issues, on the grounds that the peruser, similar to Gulliver, giggles at them as opposed to understanding that they are issues of his own. What a considerable lot of Swifts pundits don't understand is that his works highlight a dull, wound comical inclination (Bloom, Gulliver 40, 43). He utilizes comedic suggestions and afterward frightens the peruser into stun when these absurdities show exactly how malice man can really be (Brady 71). He sets up perusers with a flip-flop among the real world and the creative mind (Tuveson 58). What the peruser from the outset neglects to acknowledge, and afterward is frightened to at long last observe, is that the joke is entirely him (Bloom, Gulliver 44). Quick is scrutinized for Gullivers capacity to compose three positive books in Gullivers Travels, when it is said that Gulliver composes the story after his movements are finished and he is totally appalled by the activities of humanity (Ward 124). These abnormal activities by Gulliver really exhibit man as over-restless, somebody who acts speedily and unreasonably and therefore blunders in his work (Bloom, Gulliver 45). The peruser can feign exacerbation at Gullivers shortfalls, yet while scrutinizing his composing the peruser is condemning himself for being deficient and muddled (Ward 125). In opposition to analysis, Gullivers Travels is undeniably more sound than it is given acknowledgment for (Bloom, Gulliver 45). Another c onfusion of pundits is that the activities of Gulliver are proposed to demonstrate that individuals are not exactly human (Ward 8). This was never Swifts goal. Gulliver initially puts on a show of being a keen individual, and the peruser can without much of a stretch identify with him. Gulliver later acts absurdly with hubris pride, and the peruser dislikes Gulliver and, subsequently, himself (Brady 72-73). Parody like this fills in as a reminder for the peruser. Quick continually moves the mentalities of his characters, for example, Gulliver, to shield the peruser from becoming careless. These movements bother the perusers sees on life and he is compelled to change (Ward 7, 15). Jonathan Swift is by and by unreasonably assaulted for his references to human waste in a few of his works. George Gilfillan was affronted to the point that he alluded to Swift as a minor Satan. Gilfillan and others are pestered most by a few notices of dung in Gullivers Travels, particularly the showering of Gulliver, and they neglect to see the genuine noteworthiness of the feces. Quick set out to move their annoyance to demonstrate that man regularly gets agitated with ordinary activities which are unimportant contrasted with the master plan, which is sin, for example, pride (Knowles 38). William Hazlett shields Swift on this issue, guaranteeing that the individuals who assault Swift over the excremental references are uninformed wolves in sheep's clothing (Bloom, Gulliver 31). Quick doesn't place himself above analysis as he has regularly been blamed for doing. He assaults the deceptions of society and, as a citizen, is compelled to assault the indecencies of himself (Ward 2). It has been a typical analysis that Swift is silly for utilizing two distinct voices in a single piece. In any case, this lone brings up that Swift doesn't place himself above analysis, as it features the way that his musings and sentiments are as indiscernible as the remainder of societys. Quick loves to de ride society, however in this manner, he is likewise ridiculing himself (Tuveson 8). Quick has unjustifiably been alluded to as vain. Pundits guarantee his works are of a self absorbed inclination that makes straightforward individuals look weak and beguiling (Knowles 34). Quick can't in any way, shape or form be a narcissist, as he has clarified that his main foe is keeps an eye on pride (Tuveson 102). He utilizes Gulliver as his central methods for passing on this. Gulliver lies right off the bat in Gullivers Travels to safeguard his convictions and notoriety, declining to make an effort to his sense of self for the sake of trustworthiness (Brady 6). To some extent one of Gullivers Travels, Gullivers vision is slanted by the beams of the sun. This speaks to keeps an eye on visual impairment towards ethical quality and qualities. Afterward, Gulliver is looked by the Lilliputans and they discover glasses in his pockets. This demonstrates keeps an eye on vision (which means his persp ectives and convictions) can't be trusted in light of the fact that his pride disrupts the general flow (Bloom, Gulliver 11-12). To blame Swift for acting naturally cognizant is as foolish as whatever other allegation that has been leveled against him. In Swifts time, society started to take a gander at pride as not a bad habit but rather an ethicalness, and Swift felt it was his obligation to change this (Brady 28). Maybe the most well-known analysis leveled against Jonathan Swift is that he is a skeptic. Walter Scott, goaded by Swifts disposition towards man, ventured to such an extreme as to consider him an outrageous skeptic and said Swift was brimming with mental illness (Knowles 37). David Ward goes similarly as far, asserting that Swift needs totally that intuitive regard for the estimation of human life which is a basic piece of humankind (9). As Ronald Knowles calls attention to, these assaults on Swift demonstrate that his faultfinders concurred with what he was stating an d they turned to deceitful allegations basically out of dread and neurosis (38). Quick doesn't abhor man for lacking good flawlessness. Man can't be relied upon to have th
Saturday, August 22, 2020
The ethical topic is Doctors giving narcotic orders for nurses to Essay
The moral theme is Doctors providing opiate orders for medical caretakers to complete to addicts despite the fact that the specialists know their patie - Essay Example The end will be obvious that medical caretakers must keep the patientsââ¬â¢ eventual benefits on the most fundamental level as they look to be the patient promoter and do no mischief. Moral Dilemma: Doctors Giving Orders for Nurses to Carry Out to Addicts Even Though the Doctors Know Their Patients Are Addicted to the Narcotics There are many recorded occasions where medical attendants have been put in moral circumstances with regards to following doctorsââ¬â¢ orders. One of these circumstances is whether to do those requests in the event that they mean offering opiates to known addicts. Modified throughout the years, the Nurseââ¬â¢s Associationââ¬â¢s Code of Ethics for Nurses with Interpretive Statements carefully passes on the significance of responsibility and patient support. Essential to the topic of this article are a few Provisions legitimately expressed in the Code. In Provision 2, ââ¬Å"The nurseââ¬â¢s essential duty is to the patient, regardless of whether a n individual, family, gathering or community.â⬠Provision 3 states, ââ¬Å"The nurture advances, advocates for, and endeavors to ensure the wellbeing, security, and privileges of the patient,â⬠And Provision 4 reads,ââ¬Å"The nurture is mindful and responsible for singular nursing practice and decides the suitable appointment of undertakings predictable with the nurseââ¬â¢s commitment to give ideal patient care.â⬠To increase a more clear comprehension of the extent of morals comparable to the topic, a meaning of certain terms would be advantageous. ââ¬Å"Ethicsâ⬠is characterized by Merriam-Webster as ââ¬Å"a set of good standards: a hypothesis or arrangement of good valuesâ⬠(morals, 2011), while the American Heritage Dictionary characterizes a ââ¬Å"narcoticâ⬠as ââ¬Å" an addictive medication, for example, opium, that diminishes torment, changes state of mind and conduct, and as a rule incites rest or stuporâ⬠(opiate, 2011). In the art icle ââ¬Å"Nurses Struggle with Ethical Dilemmas,â⬠Christine Mitchell (RN, MS, FAAN, Director of Ethics at Boston Childrenââ¬â¢s Hospital and Associate Director of Clinical Ethics at Harvard Medical School in Cambridge, Massachusetts) is cited as saying, ââ¬Å"The significant thing is for attendants to tune in to their internal voices and ask themselves, ââ¬ËAre we doing the privilege thing?ââ¬â¢ Pay consideration regarding that voice.â⬠(Boivin, 2009) In looking to make the best choice, the medical caretaker must priest to the entire individual, as Marg Hutchison cites Joyce Travelbee in ââ¬Å"Unity and Diversity in Spiritual Care,â⬠A nurture doesn't just try to lighten physical torment or render physical consideration - she pastors to the entire individual. The presence of misery, regardless of whether physical, mental or profound is the correct worry of the nurse.â⬠(Hutchison, 1998) In clinging to this standard, the Hospice Patientââ¬â¢s Allia nce centers around five privileges of medication organization that apply to attendants utilized in any clinical setting. These rights, as recorded in the article ââ¬Å"Dangers of Leaving Medications Outâ⬠incorporate the correct patient, medication or drug, portion of prescription, course of organization, and time (recurrence). (The Hospice Patientââ¬â¢s Alliance) The medical caretaker must, along these lines, everlastingly know about the patientââ¬â¢s eventual benefits. Clearly genuine results could happen if both of these rights was damaged. During the time spent offering prescription to patients, the medical attendant may address why the specialist would recommend opiates to a known someone who is addicted. There waits the likelihood that the medical caretaker might be unconscious of the all out thinking behind a doctorââ¬â¢s orders. Maybe the patient is looking for interminable relief from discomfort. Maybe it is a
Sunday, August 2, 2020
How to Write the Stanford University 2017-18 Supplemental Essays
How to Write the Stanford University 2017-18 Supplemental Essays How to Write the Stanford University 2017-18 Supplemental Essay How to Write the Stanford University 2017-18 Supplemental Essay The Stanford University supplement is a BEAST. There is no way around it. Admissions Officers really want to weed out the uncommitted students and learn more about the applicants who are willing to put the time in to submit an extensive and detailed application. We made you a guide on how to brainstorm and write the essays for Stanford, but if youre more of a visual learner, watch our two part video below! The Stanford University supplement is a BEAST. There is no way around it. Admissions Officers really want to weed out the uncommitted students and learn more about the applicants who are willing to put the time in to submit an extensive and detailed application. We made you a guide on how to brainst The Stanford University supplement is a BEAST. There is no way around it. Admissions Officers really want to weed out the uncommitted students and learn more about the applicants who are willing to put the time in to submit an extensive and detailed application. We made you a guide on how to brainst About CEA HQView all posts by CEA HQ » Ready to get started? We can help! CONTACT US »
Saturday, May 23, 2020
Augustines Confessions Essay - 1384 Words
Augustineamp;#8217;s Confession nbsp;nbsp;nbsp;nbsp;nbsp;Augustine on his own view stole the fruit for the mere enjoyment of the sin and theft that the stealing involved. He says in (II,4) nbsp;nbsp;nbsp;nbsp;nbsp;nbsp;nbsp;nbsp;nbsp;nbsp;amp;#8220;Behold, now let my heart tell you what it nbsp;nbsp;nbsp;nbsp;nbsp;nbsp;nbsp;nbsp;nbsp;nbsp; looked for there, that I should be evil nbsp;nbsp;nbsp;nbsp;nbsp;nbsp;nbsp;nbsp;nbsp;nbsp; without purpose and there should be no nbsp;nbsp;nbsp;nbsp;nbsp;nbsp;nbsp;nbsp;nbsp;nbsp; cause for my evil, but evil itself. Foul nbsp;nbsp;nbsp;nbsp;nbsp;nbsp;nbsp;nbsp;nbsp;nbsp; was the evil, and I loved it.; Augustine knew that what he was doing atâ⬠¦show more contentâ⬠¦At the time of the act he was thinking of how much his actions pleased him. In book six of his confessions Augustine starts to think about the actions he had committed and how they were unlawful, not only in society but also in the world that God created. However as Augustine starts to show remorse for his sins it does not change the fact that he stole the fruit from the tree for the pleasure of sin. nbsp;nbsp;nbsp;nbsp;nbsp;According to Aristotle in his Nicomachean Ethics, a self indulgent person is led on by his own choice, since he believes that he should always pursue the pleasures of the moment(1147a). According to Aristotle, and viewing the crime in which Augustine committed, Augustine acted in self - indulgence or vice. Augustine knew that the crime that he was going to commit, the crime of stealing fruit, was indeed wrong and was a sin. He went ahead and committed the crime anyway, and he did it for pleasure. He was caught up in the moment of the act. Nothing else mattered at that time except for the act itself and the enjoyment that he was going to gain from it. Aristotle in this case would categorize him as acting in self-indulgence. Whether Augustine knew it or not his actions were pre-meditated, carried out, and enjoyed whether the action was good or bad. This would make his actions actions of vice. Augustine acted withoutShow MoreRelatedAugustine s Confessions By Aug ustine1137 Words à |à 5 PagesIn Augustine s Confessions, Augustine tells his entire life story leading up to his conversion to Christianity. Throughout his life, he experiences a vast amount of events, both that had major impacts and minor impacts. In the Confessions, Augustine called these events ââ¬Å"episodes. The episodes supported his transformation of who he was into who he wanted to be after his conversion to Christianity. Certain episodes in Augustineââ¬â¢s life led to inspiring moments, while others lead to grief and painRead MoreConfessions by Augustine Essay752 Words à |à 4 PagesConfessions by Augustine Truth and piety are two terms Augustine illustrates throughout his book Confessions. There are two types of truth: the truth found in God, but also the truth found in oneself. The truth found in and through God is quite obvious throughout the whole book. The other requires the reader to search deeply in the text. Augustine feels that if you develop self knowledge, then you can find truth. You have to be true to yourself and God. With self knowledge, you can revealRead MoreThe Confession By Augustine Of Hippo1365 Words à |à 6 Pagesthoroughly answered this question in chapters eight, nine, and ten of his biography, The Confession, was Augustine of Hippo. Throughout this biography, he goes through the struggles, successes, and ultimately the way that God reached out to him throughout his own conversion to Christianity. Augustine explains that God reaches out to humans by the examples of others and changes in their own personal lives. Augustine begins this writing by explaining the struggles of life without God and how these strugglesRead MoreAugustine Confessions Essay771 Words à |à 4 Pagesï » ¿Sarah Kaldas Humanities I Dr. Borucki May 5 2014 Augustineââ¬â¢s Confessions Augustineââ¬â¢s Confessions is a diverse blend of autobiographical accounts as well as philosophical, theological and critical analysis of the Christian Bible. Augustine treats his autobiography as an opportunity to recount his life and mentions how each event in his life has a religious and philosophical explanation. Augustine had many major events happen in his life but only 3 events would deem of extreme importance to hisRead MoreAugustine s Confessions By John Augustine Essay1721 Words à |à 7 Pagesbook Augustineââ¬â¢s Confessions, there were multiply themes in the story which made the book great. One theme of Augustineââ¬â¢s Confession is the problem which many Americans face today. That is evil. Evil is everywhere in the world. Augustine lost his mistress, mother and even his own son in the book. He had to also figure out why god is punishing people with these action. So found out the answer to the evil, Augustine ask why is God good and still allows suffering to e xist. Augustine found out that evilRead MoreSt. Augustine s Confessions1914 Words à |à 8 PagesSt. Augustine was a theologian and philosopher born in Africa to St. Monica. Although he is now known as a an incredibly influential Christian writer and thinker, his early years were defined by rebellion and discord that did not, in the least, reflect Christianity or the values that he is now known for supporting. His early years were freckled with mindless disobedience, wretched behavior, and characterized godlessness that makes his conversion to the faith incredibly remarkable and one that isRead MoreThe Confessions Of Saint Augustine900 Words à |à 4 PagesThe Confessions of Saint Augustine are a plethora of mini-books within a book. There are a total of thirteen books. Each book depicts a short part of his life. Going from infancy to his adulthood. The book all together is his thoughts of sin. The Saint, had a variety of different stories. Have you ever heard the term ââ¬Å" Don t knock it till you try it ! â⬠Well, its obvious he s tried just about everything you can think of at that time. The philosophy that he had for sin is a form of disordered loveRead MoreConfessions By Augustine Of Hippo1839 Words à |à 8 PagesConfessions is an autobiography that Augustine of Hippo writes to depict his journey of finding the religious truth regarding the origin of evil. In his autobiography, Augustine argues that Christianity possesses the most compelling answer to the origin of evil, and shows that Christianityââ¬â¢s definition evil is the extent that a person has strayed away from God. He argues that human free will leads to sin when a person pursues worldly desires instead of dedicating their lives to God, which in turnRead MoreAnalysis Of Augustine s The Confessions 1068 Words à |à 5 PagesMonnica With thirteen books making up the Confessions, it is hard to say what had played the most important role in Augustineââ¬â¢s life. Obviously, a crucial point in the story was Augustineââ¬â¢s conversion or return to Christianity. Readers see this as something Augustine was struggled with, from stealing fruit to joining the Manicheans. Through all of his struggles about his faith, his mother Monnica was devoted to his conversion. In this brief paper, I will discuss who Monnica was, how she played aRead MoreJohn Augustine s The Confessions St. Augustine1466 Words à |à 6 PagesIn Chapter IV of his Confessions, St. Augustine describes his terrible grief at the death of a friend, and then to the adherence to mortal things, and why he regrets them. He writes that everybody experiences death differently, but the death of his close friend made him realize that this life is temporal. He continues saying that he was stricken with grief from the death of his friend and that made him want to move away from his hometown. Everything there brought his friend to mind, and he was always
Monday, May 11, 2020
The Masque Of The Red Death Symbolism Analysis - 954 Words
Darkness of Symbolism Gothic literature often has a common theme of fear and/or death. Author Edgar Allan Poe is the most well known gothic writer because of his famous dark and frightening short stories such as ââ¬Å"The Masque of the Red Death.â⬠Poe is so popular because of his ability to write stories that leave lasting effects on all readers. In this story, he uses many small symbols that then relate to the major symbols, such as Prince Prospero, his name represents his prosperous lifestyle. The setting is in a big fancy castle at a party that is an escape from the reality of death for the guests. Poe uses several strong symbolic elements to lead to his overall theme of inevitable death. Poe includes many examples of literary devicesâ⬠¦show more contentâ⬠¦Then there is white which symbolizes the elderly, and then the violet room was for the dying. The final room was black and that is where death took place. In the story once the characters enter the castle-like abb ey of Prince Prospero, nobody could enter or exit because of the welded locks that kept all evil from the outside world out. Another example of Poeââ¬â¢s symbolism is when he is describing the clock and its effect on the guests, ...that there stood against the western wall a gigantic clock of ebony. Its pendulum swung to and fro with a dull, heavy, monotonous clang; and when the minute hand made the circuit of the face, and the hour was to be stricken, there came from the brazen lungs of the clock a sound which was clear and loud and deep and exceedingly musical, but so if peculiar a note and emphasis that, at each lapse of an hour, the musicians of the orchestra were constrained to pause, momentarily, in their performance, to hearken to the sound; and thus the waltzers perforce ceased their evolutions; and there was a brief disconcert of the whole gay company (Poe 449). This shows the ginormous symbolic clock that hangs in the final black room of death, it chimes every hour and when it does, it sends a widespread panic throughout the entire castle. This symbolizes the time each person has until death and the clock is a reminder that death will come for everyone eventually. Poe uses these symbols to relate his readers back to the thought ofShow MoreRelatedEdgar Allan Poe s The Masque Of The Red Death1225 Words à |à 5 Pagescolonial poems, to the twisted mind of Edgar Allan Poe, there is a connection. Poeââ¬â¢s ââ¬Å"The Masque of the Red Deathâ⬠may not seem to portray the ideas of religion but through close examination, the association will become less cloudy. Poeââ¬â¢s use of symbolism, narrator, word choice, helps readers unmask the idea of religion. Poeââ¬â¢s use of symbolism is very evident throughout the story of ââ¬Å"The Masque of the Red Deathâ⬠. Much has been made about the meaning of the rooms that fill Prince Prosperoââ¬â¢s lavishRead MoreAvoiding Reality: ââ¬Å"The Masque of the Red Deathâ⬠Analysis858 Words à |à 4 PagesAvoiding Reality: ââ¬Å"The Masque of the Red Deathâ⬠Analysis Throughout the gothic horror short story, ââ¬Å"The Masque of the Red Deathâ⬠, Edgar Allan Poe illustrates the struggle of an egotistical prince who refuses to face the inevitable reality of death. Through the downfall of the protagonist, Poe establishes the idea that the inability to face reality often leads to the destruction of the mind. The downfall of the Prince is emphasized by Poeââ¬â¢s use of characterization, setting, and symbolism. In the shortRead MoreLiterary Analysis Of Edgar Allan Poe s The Masque Of The Red Death1409 Words à |à 6 PagesA Literary Analysis of Edgar Allan Poeââ¬â¢s ââ¬Å"The Masque of the Red Deathâ⬠Edgar Allan Poe is popularly known as a Gothic short story writer. He has produced many gruesome stories, including the short story ââ¬Å"The Masque of the Red Deathâ⬠. In this short tale, Prince Prospero decides to lock himself and his friends of the court into a magnificently decorated abbey to escape becoming ill of a disease which has caused half the people in his land to perish. The Prince provides indulgences and throws partiesRead MoreThe Masque Of The Red Death1592 Words à |à 7 Pagesexcellent example of this struggle in his short story ââ¬Å"The Masque of the Red Deathâ⬠. While a deadly plague is ravaging his country, a prosperous prince, quite appropriately named Prospero, takes a thousand of his fellow elites into seclusion at an abbey, where he later holds an elaborate masquerade. It is then towards the end of this masque, held in an imperial suite of brilliantly colored but bizarre rooms, that the plague, known as the ââ¬ËRed Deathââ¬â¢, finally make s its way into the abbey, inevitably killingRead MoreThe Masque Of The Red Death1679 Words à |à 7 Pages Power in ââ¬Å"The Masque of the Red Deathâ⬠ââ¬Å"Frail humanity can never escape the ravages of timeâ⬠. Humans are born and will eventually die; itââ¬â¢s the cycle of life. No one can prevent death, but it does not stop people from trying to prolong life. Fate is inevitably predetermined; death is our predetermined fate. In the allegory ââ¬Å"The Masque of the Red Deathâ⬠, written by Edgar Allan Poe in 1842, Poe teaches that death is predestined and that you cannot avoid fate. Poe focuses in on an unusual characterRead More An Analysis of Edgar Allan Poes Psychological Thriller Essay3707 Words à |à 15 PagesAn Analysis of Edgar Allan Poes Psychological Thriller Outline I. Prelude II. Brief introduction to Adgar Allan Poe 1. 1. Allan Poes Life 2. 2. Allan Poes Works and Literary Achievement III. Adgar Allan Poe -- A Post-Gothic Writer 1. 1. Gothic Introduction 2. 2. Analysis of Two Horror 1) 1) The Fall of the House of Usher a) a) Setting b) b) Characters c) c) Point of View 2) 2) The Masque of the Red Death a) a) Setting b) b) Characters Read MoreThe Masque Of The Red Death By Edgar Allan Poe2034 Words à |à 9 Pagesatmosphere exudes a dream-like quality, which calls into question if the events are simply a product of oneââ¬â¢s imagination. This situation is comparable to that of ââ¬Å"The Masque of the Red Deathâ⬠by Edgar Allan Poe. Originally published in 1842, this narrative tells the story of a wealthy noble, Prince Prospero. An extremely deadly plague, the Red Death, has devastated the land, and Prince Prospero invited a group of a thousand friends to one of his abbeys to hide away from the disease. Everything about the partyRead MoreThe Masque of the Red Death2065 Words à |à 9 Pageswill serve a tyrant.ââ¬â¢ I chose THE MASQUE OF THE RED DEATH by Edgar Allen Poe as my short story. The theme that I selected from that story is Mortality. Thesis Statement on Mortality: Even though fear of the unknown is scary, should mortality actually be something we fear? Death effects everyone the same. It ends life for all equally and death is lifeââ¬â¢s only certainty. Some of the literary elements Edgar Allen Poe uses in this story include symbolism, imagery, and allegory. Examples ofRead MoreWhy Should We Care?1748 Words à |à 7 Pagesones around him, and the rest speaks of his belief that no matter what he did, his personal demons haunted him and made him think and act differently. ââ¬Å"ââ¬ËAloneââ¬â¢ is the epitome of Poe s thinking and his view of himself in the eyes of the publicâ⬠(Analysis Of Poe s Alone). Based on that thought, the poem is essentially Poe explaining how he thinks others view him, showing a great deal of self-awareness. Certain parts of the poem ââ¬Å"Aloneâ⬠can be tied back to Poeââ¬â¢s personal history, beliefs, and ideas
Wednesday, May 6, 2020
Calculate the Total Asset Turnover Free Essays
Question 4: Calculate the total asset turnover, the P, P, E Turnover, and the intangible asset turnover for each of the past two years. Are these turnover ratios increasing or decreasing? What might explain these trends? Total Asset Turnover is a financial ratio that measures the efficiency of companyââ¬â¢s use of its assets to product sales. It is a measure of how efficiently management is using the assets at its disposal to promote sales. We will write a custom essay sample on Calculate the Total Asset Turnover or any similar topic only for you Order Now The ratio helps to measure the productivity of a companyââ¬â¢s assets. Total Asset Turnover is calculated by Net Sales divided by Total Assets. We had to calculate the Total Asset Turnover, the Property, Plant, and Equipment Turnover, and the Intangible Asset Turnover Ratios in 2010 and 2011 for Johnson and Johnson Company. The below table shows the above ratios in 2010 and 2011. |2010 |2011 | |Total Asset Turnover = |61,587 = |60% |65,030 = |57% | | |102,908 | |113,644 | | | | | | | | |P, P, E Turnover = |61,587 = |4. 3x |65,030 = |4. 41x | | |14,553 | |14,739 | | | | | | | | |Intangible Asset Turnover = |61,587 = |1. 92x |65,030 = |1. 89x | | |32,010 | |34,276 | | For the Total Asset Turnover, there is a decrease from 60% in 2010 to 57% in 2011. For the Property, Plant, and Equipment Turnover, there is an increase from 4. 23 in 2010 to 4. 41 in 2011. For the Intangible Asset Turnover, there is a decrease from 1. 92 in 2010 to 1. 89 in 2011. Increases in the asset turnover ratio over time may indicate a company is growing into its capacity. A decreasing ratio may indicate the opposite. Asset purchases made in anticipation of coming growth (or the sale of unnecessary assets in anticipation of declining growth) can suddenly and somewhat artificially change a companyââ¬â¢s asset turnover ratio. How to cite Calculate the Total Asset Turnover, Essay examples
Thursday, April 30, 2020
Social Learning Theory and juvenile delinquency
Introduction The purpose of this essay is to examine the empirical studies of the Social Learning Theory on juvenile delinquency. Juvenile delinquency entails the term that is used to explain to young people who have not attained majority age and are involved in committing crimes. Delinquency refers to the failure to follow laws that are set by the state.Advertising We will write a custom research paper sample on Social Learning Theory and juvenile delinquency specifically for you for only $16.05 $11/page Learn More According to the sociological aspect of criminology, social interactions and individualism are the factors behind the juvenile delinquency. Usually, society does not exist as an island but rather different person interacts and this ensures that the society continues to exist. The social interaction theory and juvenile delinquency have been written extensively over the years and the studies have proved to be logically consistent and also usefu l in providing the empirical support. Thus, the studies play an important role of explaining all the social behaviors without which it is impossible to explain the causes of juvenile delinquency. The empirical studies of the Social Learning Theory on juvenile delinquency helps to provide an insight on the past, present as well as the future of criminology i.e. the study sheds light on the future directions of social interaction theory. The main aim of social interaction theories on juvenile delinquency is to explain how such social influences as religion, family and politics shapes a person over time. The social interaction theories on juvenile delinquency assume that interplay exists between an individual, the environment and delinquent acts. Explanatory concepts of social interaction theories on juvenile delinquency The social interaction theory on juvenile delinquency is comprised of four main explanatory concepts i.e. the differential association theory, definitions theory, imit ation theory and differential reinforcement theory. Differentiation association theory is a social interaction theory that was formulated by Edwin Sutherland. According to this theory, people develops deviant behaviors by interacting and associating themselves with those who engages themselves in deviant behavior i.e. one can learn positive or negative behavior through interaction. Sutherland in his Differentiation Association Theory argued that juvenile delinquency is caused by observation and social interaction. According to this theory one is deemed to act in a deviant manner as a result of association with group members who favor juvenile delinquency than those members who value the societal norms. This theory, also argues that the familiy unit is the major source of learning behaviors.Thus,if onesââ¬â¢ familiy unit is made up of people who are engaged in deviant behaviors, then one is bound to develop the same kind of behaviors.Advertising Looking for research paper on criminal law? Let's see if we can help you! Get your first paper with 15% OFF Learn More Also,the theory argues that one learns certain norms and behaviors through the internet, mass media e.t.c. formulating the differential association theory, Sutherland used three concepts i.e. the culture conflict, cultural transmission theory and the ecological transmission theory. The culture conflict concept explains the presence of many crimes in the society and also the progress towards becoming a criminal. Sutherlandââ¬â¢s theory is thus important as it helps to explain the juvenile delinquency in the society (Morrison, 1995, P.51). Definitions theory was developed by Aker and it refers to a personââ¬â¢s orientations, explanations, justifications e.t.c. that explains as to whether morally right or incorrect. Definitions theory of juvenile delinquency is thus the process whereby one evaluates the rightfulness or wrongness of a particular action. According to this theory. The l aw definitions may be specific or general i.e. a person may obey law generally and in turn violate specific provisions of the law. Definitions are comprised of behaviors that are learned as a result of interactions and other societal norms that conforms the delinquent acts. Specific definitions render one to act in a certain manner and the more one learns specific or general attitudes, the higher the chances of engaging in delinquency acts (Krohn et.al. 2009, P.104). Imitations theory of juvenile delinquency refers to the process whereby one imitates behavioral characteristics of others by observing them. The imitation theory of social delinquency was modeled by Gabriel Tarde who a French criminologist.Tarde was held the view that the regional differences that exists in crime rates are as a result of local variations i.e. alcoholism and poverty and not as a result of biological factors. Tarde also argued that juvenile delinquency is a lifestyle that is learned through social interac tion.Tarde in his imitation laws argued that juvenile delinquency is a function of interacting with people who have deviant behaviors. With this regards, a criminal undergoes through phases of apprenticeship which is similar to that of a lawyer or a doctor. Tarde came up with three laws that provided an account for the imitations and juvenile delinquency. The first imitationsââ¬â¢ law holds that people tends to imitate others when they are near one another. Thus, imitation is eminent in most cities and towns that are densely populated. The second imitation law holds that those people who are inferiors tend to imitate their superiors. With this regards, juvenile delinquency originates from the superiors and later on, descends to lower ranks.Advertising We will write a custom research paper sample on Social Learning Theory and juvenile delinquency specifically for you for only $16.05 $11/page Learn More The third imitation law by Tarde holds that, it i s possible to substitute fashions particularly when the two arises at the same time. The imitation theory of juvenile delinquency also held the view that crimes originates in the capital cities. For instance, carjacking, terrorist activities and other major crimes are prevalent in metropolitan cities as opposed to rural areas. Differential reinforcement theory of juvenile delinquency is concerned with the balance that exists between the punishments and rewards that occurs following a particular behavior. This balance plays a vital role in enabling individuals to behave in a particular manner.Thus,the more the rewards for juvenile delinquency, the higher the tendency to commit a crime and vice versa. Reinforcements and punishments can be nonsocial e.g. the direct consequences of alcoholism and drugs abuse. Causal factors of juvenile delinquency The youths use the social interactions among themselves as a means to commit crimes. The social interactions are a concern among many parents as they fear that their children may associate themselves in bad company and in turn commit delinquent acts. The social interaction among the deviant youths acts as a means through which the youths influence each other. The social learning theories that are presented by Akers, Sutherland and Marza explain that juvenile delinquencies occur in causal terms. The causal aspects of juvenile delinquency include the individual differences, social structures, cultural factors and social psychological (Burfeind, Bartusch, 2006, P.66).The individual differences includes the psychological and biological factors. Various studies of the social interaction theory on juvenile delinquency reveal that the familiy interaction plays an important role of promoting behaviors among young children. High strictness and low support contributes to juvenile delinquencies i.e. they causes an increase in post-punishment of the acts that were previously forbidden. Personality is interrelated with oneââ¬â¢s susceptibility to reward or punishment and therefore, the extraverts are usually less likely to acquire deviant behaviors. On the other hand, strong conditioning has the effect of causing inhibition of criminal behaviors particularly in environments that encourage juvenile delinquency.Thus,the success of social responsibility and socialized depends is largely dependent on onesââ¬â¢ conditionality. The studies have also considered IQ among offenders be the main reason behind juvenile delinquency (Kim, 2008, P.23). The social factors of juvenile delinquency include the inequalities and opportunities. Poverty and inequality has the effect of frustrating young people and in-turn causing them to engage in criminal activities. This is due to the fact that, they usually feel that inequality exist between what other people have and what the youth believe they ought to have. According to social control theory, delinquency arises when the social bonds are broken.Advertising Looking for research paper on criminal law? Let's see if we can help you! Get your first paper with 15% OFF Learn More Travis Hirsch in his analysis came up with four elements of social bonds of an individual i.e. attachment, commitment, involvement and belief. Attachment is made of such aspects as sensitivity and affection for others. According to Travis, commitment included such acts as investing in conventional societies. Involvement entails spending a considerable amount of time on conventional duties whereas the belief is the extent upon which the youths feel they should abide by the laws. According to Hirschââ¬â¢s ,one is less likely to engage in criminal activities if he or she is strongly attached to the teachers or parents.Also,a child who has dedicated his or her effort and time in schoolsââ¬â¢ conventional activity is likely to conform and rarely engages in delinquent acts. However,Hirschi used empirical data that was obtained from the adolescents self reports in testing his analysis of juvenile delinquency and this made his work to be considered as unique.Aker also noted that Hirsc hââ¬â¢sââ¬â¢ work was unusual as far as juvenile delinquency is concerned (Sutherland et.al.1992,P.71). The cultural factors that have been considered as risk factors with regards to juvenile delinquency include such aspects as societal norms that promote violence in resolving disputes. Studies that demonstrated the risky factors that cause juvenile delinquency were first conducted in the early 20th century. The research was first done in the analysis by Breckinridge and Abbott in 1922 and later in the analysis by Healy in 1915.However, the research findings by Breckinridge, Abbott and Healy are newly repeated in the analysis by Loeber and Farrington in 1998.Healy in his study argued that juvenile delinquencies begins at childhood i.e. all confirmed delinquents starts their careers in their early years. Healy also noted that the repeated offenders have the greatest impact in the society as a result of their offending frequencies. Healy emphasized on the importance of beginning the treatment at an early period.Afterwards, Loeber and Farrington in their studies argued that juvenile delinquency arises through the interaction of the following factors i.e. individual, contextual, and situational as well as the community factor. They also pointed out that serious juvenile offenders starts to display their juvenile delinquency at childhood and thus there is need for early intervention.However, Loeber and Farrington in their studies contended that the juvenile offenders poses a greater challenge with regards to the juvenile justice policies due to the fact that they are responsible for virtually all the criminal activities in the society (Rosenheim, 2002, P.201-203). Juvenile delinquency and time With regards to the studies of social learning theory on juvenile delinquency history, there is a pattern that is revealed.Thus, the old studies of social learning theory on juvenile delinquency are usually discarded and they are deemed to be inadequate and outdated. Mu ch emphasis is given to new studies due to the reason that crime as well as juvenile delinquency are keep on changing with time.However, this concept is rarely studied systematically and the empirical studies of the social learning theory on juvenile delinquency have suggested that juvenile delinquency does not change with time. Primarily, juvenile delinquency involves property crimes rather than violence and its exhibited by males. Such activities usually start at a very early age and fully peaks at teenage. The delinquent acts are more common in children from poor background and in major cities and towns. As far as many young people engage in juvenile delinquency, only a few of them commits serious offenses regularly. This implies that juvenile delinquency have remained the same over the years (Bruce et.al. 2000, P.422). However, the conceptions regarding juvenile delinquency have greatly changes over the years even though the extent and nature of delinquent behaviors have remaine d them same. The reasons behind juvenile delinquency have largely been attributed the broken social bonds. However, the manner in which the theorists and researchers interpret data concerning the social learning theory on juvenile delinquency has changed (Bruce, et.al. 2000, P.33). Conclusion An empirical study of the social learning theory on juvenile delinquency reveals that several patterns have emerged over the past few years. The conceptions concerning juvenile delinquency have changed in that the past decade has seen criminals using guns in carrying out their criminal activities. There have been changes too regarding the reasons behind juvenile delinquency. The biological aspects such as IQ have however been considered as the main reason behind juvenile delinquency. The empirical study of the social learning theory on juvenile delinquency has found out that delinquent behaviors are strongly linked with family variables. The empirical studies revealed that delinquent behaviors begin at childhood but they have failed to explain the adult outcomes among the offenders. Reference List Bruce, D et.al. (2000). Juvenile delinquency: historical, cultural, and legalà Perspectives. Amststerdam: Elsevier. Burfeind, J. Bartusch, J. (2006). Juvenile delinquency: an integratedà Approach. London: Jones Bartlett Learning. Kim, H. (2008). Juvenile delinquency and youth crime.Hauppauge: Nova Publishers. Krohn, M. et al. (2009). Handbook on Crime and Deviance. Berlin: Springer. Morrison, W. (1995).Theoretical Criminology.London: Routledge. Rosenheim, M. (2002). A century of juvenile justice. Chicago: University of Chicago Press. Sutherland, E.et.al. (1992). Principles of Criminology. Maryland: Rowman Littlefield. This research paper on Social Learning Theory and juvenile delinquency was written and submitted by user Willow Stein to help you with your own studies. You are free to use it for research and reference purposes in order to write your own paper; however, you must cite it accordingly. You can donate your paper here.
Saturday, March 21, 2020
Free Essays on Compare Contrast
]... Free Essays on Compare Contrast Free Essays on Compare Contrast The death penalty capital punishment vs. life in prison is the legal infliction of the persons convicted of a severe crime. Today, in modern law, the death penalty is corporal punishment in its most severe form along with life in prison. Death penalty is irreversible: it ends the existence of those punished, instead of temporarily imprisoning them. The differences between the death penalty and life in prison are distinct but have different consequences. The first type of penalty is the death penalty. Itââ¬â¢s classified to be the most severe punishment for criminals that have committed the most severe crimes such as murder or rape. Statistics like these show that some criminals are not effected by the penalties we give them. In 1993, criminals on parole committed 84,800 crimes, this included 13,200 murders, 12,900 rapes and 49,500 robberies.(www.prodeathpenalty.com) The death penalty has the potential to be a very effective deterrent. The average inmate spends 9 years on death row costing the state substantial amounts of money. Life in prison is a second type of severe punishment; for criminals that commit severe crimes but maybe not as serious as murder. Life in prison is imprisonment without parole, the convicted is never released even with good behavior. Criminals are sent to a state or federal prison where they stay locked up but can work in the prison for money and get an education. On average it costs three million dollars for a life without parole inmate. This cost is from the $60,000 a year for the cell for 6 years and 1.5 million dollars for the trial.(www.prodeathpenalty.com) I think from the statistics shown, the death penalty might be a more effective deterrent. [337 words]...
Wednesday, March 4, 2020
Palindrome Definition and Examples
Palindrome Definition and Examples A Palindrome is a type of word play in which a word, phrase, or sentence reads the same backward or forwardsuch as Madam, Im Adam.Ã Semordnilaps (the word palindromes in reverse) are words that spell other words when spelled backwards (for example, star/rats, drawer/reward). Aibohphobia is the palindromic term for an irrational fear of palindromes. Palindrome Examples popdeedkayakcivicradarleveldeifiedrotatorrepapertestsetracecarredividerdetartratedtattarrattat(James Joyce, Ulysses, 1922)Wassamassaw(from an American Indian name for water, a swamp outside of Summerville, South Carolina)A man, a plan, a canalPanama!Able was I ere I saw Elba.Too badI hid a boot.Do geese see God?Murder for a jar of red rum.Drab as a fool, aloof as a bard.Go deliver a dare, vile dog![Caption below a cartoon of a family sitting around a dinner table; the boy is speaking]Mom, Dad, sisIm not like youIm not a palindrome.(Paul Karasik, The New Yorker, January 21, 2013)Norma is as selfless as I am, Ron.(attributed to poet W.H. Auden)Gateman sees name, garageman sees name tag.Some men interpret nine memos.Go Hang a Salami! Im a Lasagna Hog!(title of a book on palindromes by Jon Agee, 1991)Doc: note, I dissent. A fast never prevents a fatness. I diet on cod.(James Michie, New Statesman, May 5, 1967)Once you notice that decaf backward is faced, it is but the work of a moment to invent the indignant complaint of a coffee drinker confronting the absence of regular coffee: I faced decaf! I!! The same process yields a tailors cranky opinion (Knits stink!) and a travel agents apology to a volcanologist: Avalon? No lava . . .(Ellis Weiner, Mind Games. Smithsonian, April 2008) T.S. Eliot, top bard, notes putrid tang emanating, is sad. Id assign it a name: gnat dirt upset on drab pot-toilet.(Alastair Reid)Are we not drawn onward, we few, drawn onward to new era? Demetri Martins Palindromes for Specific Occasions A FATHER TRYING TO CONNECT WITH HIS ESTRANGED SON BY OFFERING HIM SOME PIZZA:Son, Im odd. Dominos?A DIALOGUE BETWEEN A MAN AND HIS YOUNG SON. THE MAN IS TRYING TO TEACH THE BOY THE NAME OF A PIECE OF FRUIT AND THE DIFFERENCE BETWEEN SINGULAR AND PLURAL:Son, say a papaya.Papayas.No s.Ã A SCIENTISTS REACTION TO WHAT HE FINDS IN A PETRI DISH.P.U.! Organisms in a group.(Demetri Martin, This Is a Book. Grand Central, 2011) The Longest Palindromes Malayalam, the native tongue of the people of Kerala, is the longest palindromic language-name. The credit of the longest palindromic place-name goes to Kanakanak, which is near Dillingham, Alaska, USA. The 19-letter Finnish word saippuakivikauppias, meaning a dealer in caustic soda, is the longest known palindromic word. . . .The first palindromic sentence in English appeared in 1614: Lewd did I live evil I did dwel. (O.Abootty, The Funny Side of English. Pustak Mahal, 2002) The Language of Magic For the most part finding palindromic words or composing palindromic phrases and sentences is a form of light entertainment. Some devotees display great ingenuity in finding long palindromes covering more than one sentence. In the past, however, palindromes have figured in the language of magic, and many have taken reversibility to be significant.(Barry J. Blake, Secret Language. Oxford Univ. Press, 2010) Dylan Thomass Semordnilap The first minister chuckled as he pointed out how [Dylan] Thomass fictional village in Under Milk WoodLlareggubspelled out something rather rude backwards. That shows the devilment of the man.(Steven Morris, Dylan Thomas Centenary: South Wales Gets Ready to Welcome the World. The Guardian [UK], January 5, 2014) Roger Angell on the Darker Side of Palindromes [T]hat night, shortly after four, I began with the words. In a few minutes, I found gulp plug (something to do with bass fishing) and live evil, and sailed off into the best sleep I had enjoyed in several weeks. The next night brought straw warts and repaid diaper, and, in time, a long if faintly troubled snooze (ezoons). I was delighted. My palindromic skills improved rapidly, and soon I was no longer content with mere words. . . . One morning, after a mere twenty minutes of shut-eye, I met my wife at the breakfast table and announced, Editor rubs ward, draws burro tide.Terrific, she said, unenthusiastically. I dont get it. I mean, what does it mean?Well, you see, I began, theres this editor in Mexico who goes camping with his niece, andListen, she said. I think you should take a phenobarb tonight. You look terrible.(Roger Angell, A Day in the Life of Roger Angell. Viking Press, 1970) Etymology:From the Greek, running back again Pronunciation: PAL-in-drome
Monday, February 17, 2020
Journal 5 Essay Example | Topics and Well Written Essays - 250 words - 1
Journal 5 - Essay Example These images are mainly for commercial and materialistic cause and it is important to ponder on their effect they have upon our lives (Tom, 80). Notably, two images are important; the automobiles and food. These images inform us on our culture: need for nourishment, pleasure and the conquering of time and distance. Minimalist art attempted to avoid allegorical associations, symbolism, and suggestions of spiritual transcendence of the previous generation of painters by stressing on their obscurity on expressivism. They started in painting and later establishing themselves in sculpture where they used objects, which were industrially produce to reduce the personal artistic signature of work. They endeared the simplicity in both the form and content by removing personal expression, which allows the audience to see composition without the distraction of the themes. They have the impersonal attitude and land art as they use the simple forms. In contrast to the previous art, the minimalist art is not about self expression but objective in their work (Tom 90). However, many modern Pop-arts aroused a new trend in creativity and diversity of modernism reflecting the values of so-called formalist artist criticize minimalist art as people who misunderstood the modern dialect of painting and
Monday, February 3, 2020
Password Cracking System Research Paper Example | Topics and Well Written Essays - 6250 words
Password Cracking System - Research Paper Example Protecting an individual's data by restricting access to it can be done by means of placing a password entry request mechanism every time that particular data is accessed. There are however many means whereby which these passwords can be nullified. The Systems that enable the nullifying of passwords are referred to as "Password Cracking Mechanisms". This report is intended to throw a detailed light upon which password cracking mechanisms are and how they come into effect. Background The internet is an open medium which is accessible to just about anyone who logs on to it. While it has many benefits the internet is also not free of potential harmful activities. If personal information is left insecure and un attended on the internet there is a grave possibility that someone may alter it out of inquisitiveness or for the particular reason of harming information. It is in order to refrain from the altering of information that data is kept password protected. Data Integrity Data Integrit y is a fundamental concept that governs the transmitting of data and information from one point to another. One a broader scale it refers to the accuracy and consistency with which data traveling is made possible. Passwords, An Introduction Passwords are an inevitable part of the digital life that human beings lives nowadays. They are all around man. Every cell Phone holder needs them in order to authenticate himself to their personalized mobile phone. Even the broadband service providers need authentication from each user that connects to their Service stream. It is often required from users of passwords that they keep complex passwords that are unusual and difficult to guess so that they may not be guessed/hacked by unwanted internet users. One of the recommendation is also that multiple passwords are used to access websites and online services such as email and internet banking etcetera. Passwords are also used to secure computing systems and personalized files. Passwords pose to be safeguards of the security of an individual as long as they are not cracked. The reason that passwords are known to the concerned individual himself only passwords are thought to be secure. Problem with Passwords The problem with passwords is that individuals keep them such that they are either too easy to remember or too strong, so much so that they have to be written down. The simpler the passwords are, the easier and less time consuming it is to crack them. Research has shown that a password that is devoid of any punctuation marks and capital alphabets and is based on six characters takes around 'less than six seconds' to crack. This cracking duration changes to eight point five (8.5) days if the password is composed of alpha numeric characters. This is possible since al all small alphabet six digit password has the possibility of twenty six possibilities at each alphabet position for six times in the entire password. Similarly an alphanumeric password has the possibility of having 36 possibilities at each character position (since there are 26 alphabets and 10 numeric digits.) Since the common masses are unaware of the improvement in security just by the addition of a number as part of the password characters the percentage of people taking advantage of this edge in security are very few. A research conducted by iFusion Labs, suggests that around twenty percent of the digital technology users still keep very easily, simple and guess-able passwords- such as the names
Sunday, January 26, 2020
Sociocultural Theory Individuals Involvement In Social Interactions Education Essay
Sociocultural Theory Individuals Involvement In Social Interactions Education Essay Sociocultural theory (SCT) illustrates how an individuals development is connected to cultural, social and historical framework. The main focus of SCT, in particular, is an individuals connection and involvement in social interactions and culturally controlled activities which shape and construct mental development. Sociocultural perspective centres on the social framework as fundamental to learning. It lays emphasis on the importance of social interactions by communicating and instructing in learning, highlighting that the social environment is not just the place where learning happens, it is integral to it. SCT suggests learning is a cultural action, young children are seen as novices within a cultural setting that learn from elders of that way of life, therefore, learning can be either formal or informal and achieved via parents, siblings, friends, teachers etcà ¢Ã¢â ¬Ã ¦ This results in children learning about the practices, beliefs and values of the community they grow up in or are placed in, consequently learning to become members of that community/group. SCT also explains and acknowledges individual differences in learning via the Zone of Proximal Development (ZPD) (Vygotsky(1896 -1934)). This is the gap amid what an individual is capable of doing on their own and what they can do with assistance of a knowledgeable other, ensuring that a child can accomplish jointly what s/he could not achieve alone. A major scholar that was vital to the progression of cultural-historical psychology and creator of SCT as we now know it, was Lev S. Vygotsky (1896 -1934). Vygotsky was a Russian psychologist whos work was banned and prohibited under Joseph Starlin in 1936, this ban was later lifted in 1956 three years after Stalins death. Vygotsky first started working as a psychology teacher in 1917 and during this period he was accumulating information simultaneously for his thesis and a book that was to be named Pedagogical Psychology, of which, was published in 1926. Vygotsky inspired a lot of original research and his works were translated into English in the 1960s. He also became influential within education around the 1980s and to this day. (http://vygotsky.afraid.org/#TimelineVygotskysLifeWorks) Vygotskys work was based on Marxist and social constructivist theories. Vygotsky stated that his academic focus was to learn from Marxs whole method how to build a science, how to approach the investigation of the mind (Vygotsky, cited Ratner(1997)) and also build upon an overt Marxist psychology. Vygotsky believed Marxist psychology is not a school amidst schools, but the only genuine psychology as a science. A psychology other than this cannot existà ¢Ã¢â ¬Ã ¦everything that was and is genuinely scientific belongs to Marxist psychology (Vygotsky, cited Ratner(1997)). Vygotsky suggested that development took place on two planes, that of the social plane via interaction and through a psychological plane as learners internalise meanings, for example, putting together a jigsaw puzzle or reading a picture book. He also believed that cognitive development occurred through conversations and interactions with more capable members of a group/culture. SCT took into account aspects of creativity and that education should not solely be concerned with learning knowledge and skills but for children to develop the capacity to think clearly, to plan and be able to pass on their understanding via interaction and communication. The key to human intelligence, Vygotsky discovered, was to effectively utilize different types of tools, not the material tools we use to increase our physical capabilities such as cutlery or levers, but psychological tools extending mental probabilities such as language and writing. These tools are described as cultural tools, of which, Vygotsky believed language to be the most important of all; as language facilitates humans to make sense of the world, is the medium of sharing knowledge and is the basis of thought. The interrelationship of language and thought was also a factor Vygotsky held to be of prominence in an individuals development. It is often noticed that young children run a commentary of what they are doing and seeing, a child develops this external speech which later in life becomes internalised as thought, therefore, speech formation that is mastered by children then becomes the basic structures of their thinking. Vygotsky was a prolific writer; he successfully built up a plethora of ideas in his short life as a scholar (he died when he was just 37 years of age of Tuberculoses). As a result, whilst a good deal of the framework for SCT was presented by Lev Vygotsky; growth, expansion and enhancement of SCT is evident in text regarding cultural-historical activity theory (Cole, 1996; Cole Engestrom, 1994) and activity theory (Chaiklin Lave, 1993; Leontiev, 1981) Further to this, in the Soviet Union, the Kharkov School of Psychology was vital for preserving the contribution of Lev Vygotsky. There, the students accomplished new avenues of subsequent development. Jerome Bruner was firstly influenced by Jean Piagets work of cognitive development although later by Vygotsky whos work he broadly developed. Brunner agreed with SCT that a childs social environment, and for the most part, social interaction were particularly imperative in the process of development and learning. Bruners theory of scaffolding is a theory that stemmed from Vygotskys theory of ZPD. Focusing on learning via communication between child and adult. Scaffolding refers to the gradual retraction of adult influence and direction, as the child develops greater mastery of a given task. Another academic that built upon Vygotskys works of SCT include Barbara Rogoff, she writes: Childrens cognitive development is an apprenticeship-it occurs through guided participation in social activity with companions who support and stretch childrens understanding of and skill in using the tools of the culture (1990:7) Its evident that Rogoffs theory of guided participation builds on Bruners theory of scaffolding, highlighting that childrens cognitive development takes place in a social context while expanding SCT beyond language-based dialogue; as the guided learner is also guided by the books that they read, the internet sites they visit and the importance of other such methods of unspoken communication. Rogoff has sourced many books on psychology, one of which The Cultural Nature of Human Development'(2003) examines, amongst many other things, the role of culture in human development and recognizing the arrangement of similarities and differences between cultural communities. For instance, the involvement children have in activities that their elders carry out in the community, which is subsequently the passing on of knowledge and cultural tools. This notion originates and builds upon Vygotskys SCT. Having presented SCT, I will now briefly put forward the theory I will compare it with which is the Piagetian developmental model. Piagetian developmental model was founded by the work of Jean Piaget (1896 1980). He was a SwissHYPERLINK ../../../../../../../wiki/Developmental_psychologist psychologist and philosopher who believed childrens education was extremely important. As a result, his work focused largely on the development of infants in particular, he was so interested in this area that he gained a lot of his empirical evidence from observing and interviewing his own three children. Piagetian developmental model refers to how the individual understands things and gains knowledge in terms of developmental stages and learning styles. It is about the individual acting as the active agent whom interacts with the world that surrounds them. According to Piaget, the child is someone who constructs his own moral world view, who forms ideas about right and wrong, and fair and unfair, that are not the direct product of adult teaching and that are often maintained in the face of adult wishes to the contrary (Gallagher Reid (1979): 26). Piaget was a professor of psychology at the University of Geneva (1929-1975) and restructured the cognitive development theory into stages, which built upon previous work from James Mark Baldwin(1861-1934) an American philosopher and psychologist. These four developmental stages are (1) infancy, (2) pre-school, (3) childhood, and (4) adolescence. Each stage has a cognitive construction which dictates the childs way of thinking and the childs grasp of reality, as the child goes from one stage to the next, except the last, there is always an insufficient understanding of reality, a disequilibrium is caused which in turn results in the reorganisation of thought structures. The four development stages are described in Piagets theory as: Sensorimotor stage: from birth to age 2 years (children experience the world through movement and senses and learn object permanence) Preoperational stage: from ages 2 to 7 (acquisition of motor skills) Concrete operational stage: from ages 7 to 11 (children begin to think logically about concrete events) Formal operational stage: after age 11 (development of abstract reasoning). (Rosenfield Santrock (1998)) Piaget therefore found that this theory is connected by two vital components; one part that prognosticates a childs capabilities dependant of their age/biological maturation and a theory that illustrates the way a learner develops, what steps or stages that an individual must travel through to end up with an outcome, a predetermined objective. Piaget proposes, by his theory of cognitive development, that an individual can not simply be presented with information and for them to make sense of it straight away. Consequently, a construction of an individuals own knowledge that is built by their own experiences is required. This formation of experiences can then permit learners to make schemas, these are an individuals mental structure and personal understanding of the world around them, that is accordingly changed and built upon dependent on the increase of opportunities to explore their world. The original idea of schemas was proposed by philosopher Immanuel Kant (1724-1804) as innate structures used to help us perceive the world (Eysenck (2010)). This change or upgrade is accomplished by two collaborating procedures: Assimilation and Accommodation. Assimilation is a mental process of receiving and adapting new information into the pre-existing schema. Its about making sense of something new based on what one already knows and is moderately subjective as an individual adjusts a new concept as to correspond with previous notions and ideas. For example a child knows an animal to have four legs and when that child see a dog he calls it an animal, when the child is informed that this is not only an animal but a dog assimilation takes place and from then on as s/he encounters more different types of four legged creatures the process of assimilation continues each time ending with the state of equilibrium which renders that stage or understanding as complete Accommodation can be described as a mental process one uses to become accustomed to the new information that is set before us, so for instance it is a process that takes place when there is no pre-existing schema and a whole new concept needs to be understood. For example as stated above the child accustomed to the notion of animals having four legs, so when encountering a monkey the child will have to accommodate that not all animals walk on all fours all the time. The process of accommodation can be more distressing for the learner causing a disequilibrium, especially for infants who go through the process of potty training for instance, as the whole concept is different and out of the childs comfort zone therefore this process can take a longer period of time. Piagets theory is used today in the way key stages are set up in the current primary and secondary curriculum and therefore exemplifies the magnitude of his work. There are also theorists that build upon his concept of developmental models who are known as neo-Piagetians such as Hughes, Bower and Wishart who have modified certain experiments such as the object permanence test (Bower and Wishart (1972)) and the policemen doll experiment (Hughs (1975)) which both demonstrate a flaw in Piagets experimental process. Having briefly presented the two theories of cognitive development, I will now discuss some similarities and differences, developing some of the key ideas of each theory. Piagetian developmental model and SCT mutually agree that a childs cognitive development takes place in stages (Jarvis Chandler (2001):149), however, the way in which these stages are portrayed by each theory differ. Whilst Piaget looked at a childs cycle of life from birth to adulthood as being a stage by stage learning pathway such as, preoperational stage taking place from ages 2 to 7, Vygotsky looked at the Zone of Proximal Development (ZPD) where a child is moved on from one stage of unknowing to the stage of knowing with the help and guidance of a knowledgeable other, which is not based on biological maturation and age but on an individuals personal level of attainment. Vygotskys concept of ZPD illustrates a childs existing and possible capability to do something. (Flanagan 1999 P.72). Vygotsky states that there are three stages that a learner will progress through, the first being tasks that could not be performed even with help, the second which is assisted performance where tasks are being accomplished by means of assistance from a knowledgeable other and finally the third which is independent performance where a learner can complete a task independently and without assistance. For that reason, the concept of ZPD can allow for deeper and enhanced comprehension of the learning process itself (Flanagan 1999 P.73) and also an effective way of evaluating a learners capability as opposed to generalising children into stages or bands of development, as Piaget does with his stage theory. Further to this, in one of Bruners books The Process of Education (1960) he explains his SCT view on the readiness for learning which is unlike Piagets developmental model of stage by stage learning dependant of biological maturation. He suggests that: à ¢Ã¢â ¬Ã ¦any subject can be taught effectively in some intellectually honest form to any child at any stage of development. (ibid.: 33) He goes on to refer to his concept of the Spiral curriculum: A curriculum as it develops should revisit this basic ideas repeatedly, building upon them until the student has grasped the full formal apparatus that goes with them (ibid.: 13). Piaget established a concept that a childs way of thinking differentiates as they grow from infancy to childhood right up until adulthood. This journey of stages that one passes through as one matures is segmented into four stages of cognitive development (as mentioned previously) which is defined as Piagets Stage Theory. (Ginsburg, Opper (1979):26). Piaget put forward that these stages were universal for all children, for example the progression of how a child encountered each stage was set to a fixed pathway from one stage to the next, also, he acknowledged that the speed at which a child went, from beginning to end, would vary and therefore relative to their age/maturation. The transition from one stage to the next, consequently, was only possible when the child was cognitively ready and he believed that a child should not be pushed to learn the next stage of knowledge pending that the child is cognitively complete in the previous stage. Thereforer it can be suggested thast piagets theory of stage development can be far more rigid and set, in contrast, SCT beleives stages can be re-visited and also merge together more continuously to achieve a deeper understanding of knowledge as Bruner states: To instruct someone is not a matter of getting him to commit results to mind. Rather, it is to teach him to participate in the process that makes possible the establishment of knowledge. We teach a subject not to produce little living libraries on that subject, but rather to get a student to think mathematically for himself, to consider matters as an historian does, to take part in the process of knowledge-getting. Knowing is a process not a product. (1966: 72) Therefore it is noticeable that Piagetian developmental model is individualist orientated compared to SCT which is socially and culturally orientated, relying on outside instruction. Piagetian developmental models focal point is the individual and their experiences of their world being the reason of development and in order to learn an individual has to be developed, unlike SCT, which focuses on the social interaction, cultural influence and that development comes after one has learned. As Vygotsky has stated Piagets approach is based on the premise that learning trails behind development, that development always outruns learningà ¢Ã¢â ¬Ã ¦ ((1978):80) and he explains his viewpointà ¢Ã¢â ¬Ã ¦properly organised learning results in mental development and sets in motion a variety of developmental processes that would be impossible apart from learning ((1978):90) Both theories acknowledge language as important in an individuals development yet in a totally different degree. Piagetian developmental model suggests that cognitive changes such as thinking and learning where not solely governed by linguistic enhancement or development, whereas SCT deems that language supports the child to excel in freedom of thought and accomplish further cognitive development (Flanagan 1999 P.59). Piagetian developmental model suggests that language is in motion, from the child towards the social environment. (Ginsburg, Opper (1979):84). On the other hand, SCT advocates the opposite, that language moved from the social to the individual, of which is internalised into thought. (Jarvis, Chandler (2001):150). Piaget could be criticised that his experiments and clinical interviews were inadequately designed. The tasks set out could be seen as inappropriate for children of a certain age group, instructions that were given could appear to be somewhat ambiguous and the tasks themselves boring and lacklustre. In later experiments carried out by neo-Piagetians these kind of impediments were rectified and it was evident that the childrens performance had improved a great deal resulting in them to be much more proficient than Piaget confirmed by his research. By simplifying tasks and making them more child friendly, researchers such as Bower and Wishart (1972) with their modification of the object permanence experiment, and Hughes (1975) with the policemen doll experiment, have demonstrated higher cognitive abilities in children who would not be expected to display them according to Piagets theory. Jerome Bruner writes in The Process of Education motives for learning must be kept from going passi ve they must be based as much as possible upon the arousal of interest in what there is be learned, and they must be kept broad and diverse in expression ((1960): 80). As I mentioned earlier Vygotsky suggests that egocentric speech that a child uses to problem solve for example becomes internalised as the child reaches adulthood (Jarvis, Chandler (2001):150) .Vygotsky explains in his posthumous anthology Thought and Language that: 1. In their ontogenetic development, thought and speech have different roots. 2. In the speech development of the child, we can with certainty establish a pre-intellectual stage, and in his thought development, a pre-linguistic stage. 3. Up to a certain point in time, the two follow different lines, independently of each other. 4. At a certain point these lines meet, whereupon thought becomes verbal and speech rational. [Thought and Language, Chapter 4] Yet, Piaget believed that egocentric speech just purely went along with and connected to what ever action the child was carrying out at that specific time(Ginsburg, Opper (1979):84), and once the child matured to adulthood this speech was simply not needed and disappeared. Although the two scholars had opposing views on the function and underlying principle of egocentric speech they both acknowledged and granted that it gave support to cognitive development Bruner, J. S.. The process of education . Cambridge: Harvard University Press, 1960. Print. Cole, M. Cultural Psychology. Cambridge, MA: Harvard University Press.(1996). Print Cole, M., Engestrom, Y. Introduction. Mind, culture and activity. An International Journal, 1(4), 201. (1994). Print. Chaiklin, S., Lave, J. Understanding practice: Perspectives on activity and context. Cambridge, England: Cambridge University Press. (1993). Print. Eysenck, Michael W. Cognitive psychology; a students handbook . 6th. ed. East Sussex: Psychology Press. (2010). Print. Flannagan, C. Applying Child Psychology to Early Child Development. Cheltenham: Nelson Thornes Limited (1999). Print. Gallagher, J. M, and D. K Reid. The learning theory of Piaget and Inhelder . Monterey, Calif.: Brooks/Cole Pub. Co., (1979). Print. Ginsbury, H. Opper, S. Piagets Theory of Intellectual Development. Englewood Cliffs: Prentice Hall, (1979). Print. Jarvis, M. Chandler, E. Angles on Psychology. Cheltenham: Nelson Thornes Limited, (2001). Print. Leontiev, A.N. Problems of the development of mind. Moscow: Progress Press.(1981). Print. Munari, Alberto. Jean Piaget (1896-1980). Prospects: the quarterly review of comparative education 24.1/2 (1994): 311-327. Print. Offord, L. The Mozart of Psychology.. N.p., 5 May 2005. Web. 6 Apr. 2011. Ratner, C., Prologue to Vygotskys Collected Works. Volume 5 (1997). Print. Rogoff, Barbara. Apprenticeship in thinking: cognitive development in social context. New York (NY): Oxford University Press, (1990). Print. Rogoff, Barbara. The cultural nature of human development . Oxford (UK): Oxford University Press, (2003). Print. Rosenfield, Anita, and John W. Santrock. Study guide for use with Children, ninth edition [by] John W. Santrock, Allen Keniston, Peden Blair . (1998). Reprint. Boston : McGraw-Hill, (2007). Print. VygotskyÃÅ'â⬠, L. S., and Michael Cole. Mind in society: the development of higher psychological processes. Cambridge: Harvard University Press, 1978. Print. Vygotsky, L. S. (1997). The collected works of L. S. Vygotsky, Vol. 4: The history of the development of higher mental functions (R. W. Rieber, Vol. Ed; M. J. Hall, Trans.). New York: Plenum Press. (Original work published 1941)
Saturday, January 18, 2020
The Bobo Experiment
The Bobo Experiment was performed in 1961 by Albert Bandura to try and prove that people, especially children, learn their social skills and behaviors from copying or mimicking adults in their lives rather than through heredity genes. Bandura wanted to show, by using aggressive and non-aggressive adult-actors, that a child would be apt to replicate and learn from the behavior of a trusted adult (Shuttleworth, M. 2008). These issues have been present for many years, even before the media used these factors as selling points for newspapers. During the 1960ââ¬â¢s, there was several concerns and debates about how children developed whether it be from genetics, environmental factors, or social interactions. For this reason, Bandura created the Bobo Doll Experiment to prove that children are taught from the adults in their lives through role-modeling (Shuttleworth, M. 2008). Bandura had several hypotheses about the results of the Bobo Doll Experiment that were appropriate with his vision on the concepts of social learning (Shuttleworth, M. 2008). 1. Children observing an adult role model operating in an overly hostile manner would be likely to replicate similar behavior themselves, even if the adult was not there (Shuttleworth, M. 2008). 2. Subjects who had witnessed a non-aggressive adult would be less likely to show violent inclinations, even if the adult was not present. They would be even less likely to exhibit this kind of aggression than the control group of children, who had seen no role model at all (Shuttleworth, M. 2008). 3. Bandura believed that children would be much more expected to mimic the behavior of a role model of the same sex. He wanted to show that it was much easier for a child to recognize and relate with an adult of the same gender (Shuttleworth, M. 2008). 4. Banduraââ¬â¢s last prediction was that boys would tend to be more aggressive than girls, because society has always endured and promoted violent behavior in men more than women (Shuttleworth, M. 2008). The results for the Bobo Doll Experiment showed, as expected, that children who were exposed to the aggressive model were more apt to show derivative aggressive behavior themselves. Another prediction was proved correct in that boys were nearly three times more likely to imitate physically violent behavior than girls (Shuttleworth, M. 2008). The overall conclusion of the Bobo Doll Experiment proved to be somewhat incomplete where most of the predictions were not being fully proved. It is not certain that children learn socially, however, it is likely that children watching an adult model using violent behaviors are more apt to believe that this kind of behavior is acceptable. Therefore, they may become users of this type of action themselves when faced with similar situations (Shuttleworth, M. 2008). Bandura discovered that girls were much less likely to become physically violent, but were equally as susceptible to verbal aggression as boys. This finding is often seen in society, where bullying at school, by boys, is more often of a physical nature; intimidation amongst girls tends to be more verbal and social (Shuttleworth, M. 2008). My theory on childhood development is that there are several factors that ââ¬Å"moldâ⬠a child into the adult that the child grows to become. These factors include, but not limited to, social interaction with adults and peers, environmental factors, heredity genes (i. e. , bi-polar disorders, ADHD, etcâ⬠¦), and the economic standing on their community. Children are susceptible to most things in their lives. One could envision a child as a sponge in that they absorb all information around them. Children learn manners, basic living skills, language, and the like from their closest adults (i. e. , parents, grandparents, teachers, and friendsââ¬â¢ parents). Children could possibly inherit disorders that cause obstacles in their learning abilities of how to conduct themselves appropriately in society. I think the most important factor that children learn from the adults and peers in their lives are how to solve problems with a little confrontation as possible. I feel that most adults today have trouble in this particular area; therefore, these adults are inadvertently teaching their children the same problem-solving skills that they hold when in actuality these adults want their children to solve their problems in a different and better way. The factor of an economic standing of their community is that if a child and their family live in a community of poor value, there tends to be less opportunities for a child to develop the necessary skills to survive and be self-sufficient in todayââ¬â¢s world. The communities of today need to provide outlets for children to express their dreams, concerns, and goals where the child feels safe. I think every community should have some sort of community center or boys & girls club that promotes activities for the children, counseling for the children who need and want it, study tutors for children who need assistance with their homework, and proper teachings of appropriate social interaction. In my personal life, I have discovered that, as an adult, I replicate today a lot of my motherââ¬â¢s behaviors that I saw when I was a child. Remember saying to yourself, ââ¬Å"Iââ¬â¢ll never grow up to be my mother! â⬠I do. Unfortunately, I have become her as an adult through how I conduct my attitudes, moods, facial expressions, and outlook on life. Through what I know of myself and what I experienced as a child, I can say with certainty that children are very influenced by their parentsââ¬â¢ behaviors, attitudes, and moods. Children tend to believe that their parents are perfect and can do no wrong. I think that children are too young to realize that their parents are human just like they are and are just as likely to make several, if not numerous, mistakes on a daily basis. Without question, children are influenced, guided, and ââ¬Å"moldedâ⬠by the factors of life that surround them. References Shuttleworth, M. (2008). The Bobo doll experiment. (pp. 1-1). Experiment-Resources. com. Retrieved July 10, 2009, from Experiment-Resources. com. http://www. experiment-resources. com/bobo-doll-experiment. html#ixzz0KuMD9ZEw&C
Thursday, January 9, 2020
Disability Essay Topics Tips & Guide
Disability Essay Topics Tips & Guide Disability Essay Topics: the Ultimate Convenience! Moreover, a number of the disabilities demands need careful medical checkups to diagnose any prospective health lapses, to stop future infection and injury, in addition to to offer overall body care. For instance, if an employer extends leave to new mothers past the period of recuperation from childbirth, it can't legally fail to supply an equivalent quantity of leave to new fathers for exactly the same function. In this kind of situation, disability could possibly be a significant obstacle on the best way to the professional development of individuals and to their career. To beat or overcome a few of the challenges disability victims go through, society should think of innovative ideas about how to eradicate the social barriers that impair disability function. At exactly the same time, educators ought to be alert to special needs of students with disabilities. The social commitment is necessary for educators to take care of students with disabilities as an essential part of the school community. Most people with disabilities wish to go work and find less reasons to have a personal day than the typical employee. Actually, students with disabilities aren't inferior in contrast to their peers but they simply have special needs. The Chronicles of Disability Essay Topics Alcohol usage ought to be controlled. Absolutely free Disability essay samples are offered on FreeEssayHelp with no payment or registration. It should be written in the words that an average person will understand. A disorder that is usually characterized by a considerable discrepancy between higher verbal abilities and weaker motor, visual-spatial and societal skills. What the In-Crowd Won't Tell You About Disability Essay Topics In an issue of speaking, picking out persuasive essay topics is similar to telling yourself what you wish to convey to the rest of the planet. Argumentative essay is a kind of written assignment where you're predicted to provide your opinion on a specific matter and offer evidence that supports your opinion. Regardless of the popular myth, a decent argumentative essay is more than simply hoping to show your point with a couple arguments. In reality, all of the argumentative essays follow one of the five common models that may help you with the building of the chief essay question and the manner in which you support your claims. At the conclusion of it all, your audience should have been persuaded into accepting your opinion on disability is the perfect one and that it ought to be considered in an attempt to try and bring about change. Such a statement for disability will form a great foundation for arguments considering the simple fact that it's disputable. To summarize, people with disabilities must struggle with daily life, on account of the people around them who decide to discriminate against them. For many people justice has the exact meaning. The Hidden Treasure of Disability Essay Topics Next, you should consider the method on how you need to relay it to your readers. At the exact same time, it's crucial to offer a specific solution to the question. If you take advantage of a question, utilize the problem-then-solution format. When you assess the question properly you will discover the response on your own. It's imperative that you carefully understand the essay prompt if you want to create a strong assignment. Essays are sometimes a challenging assignment for many students. If you face the task to compose a vital essay about technology, we advise you to try out the upcoming topics. The absolute most assigned tasks in your career will be essays since they are a portion of each academic course for a number of subjects. To begin writing your assignment you would want to encounter an interesting and promising topic. Communication technology essay topics may include a variety of ideas. This form of essay is somewhat hard to write, in comparison to other essays, since the art of argumentation isn't learned by every man who try to acquire it. There are several good persuasive essay topics to pick from. If you take a close look at the examples of argumentative essays written by other students, you will observe that the introduction doesn't adhere to a strict pattern. Have a look at the examples of argumentative essays on our site.
Wednesday, January 1, 2020
Prostitution in Victorian England Essay - 1245 Words
Judith Walkowitzââ¬â¢s book Prostitution and Victorian Society: Women, Class, and the State, deals with the social and economic impact that prostitution had on English society in the mid to late 19th century. Throughout her piece Walkowitz illustrates the plight of women who are in the prostitution field and that are working the streets throughout England. She starts with the background of most of the prostitutes in Victorian England then talks about the Contagious Disease Act in 1864 that attempted to curb the venereal diseases being spread by prostitutes. Walkowitz also discusses two specific cities in England that prostitution was a ââ¬Ësocial evilââ¬â¢, Southampton and Plymouth, where the repeal campaigns were successful. Most of the women whoâ⬠¦show more contentâ⬠¦The problem with the enforcement of the act was that police could arrest and inspect any woman that they suspected of prostitution, whether they were a prostitute or not. Ordinary women were sometimes suspected to degrading inspects by authorities and were humiliated and falsely held. The act were protested by various womenââ¬â¢s groups that claimed that the act was attempting to control womenââ¬â¢s bodies and that the government should go after the prostituteââ¬â¢s clientele rather than the prostitute. Prostitution was viewed by many of Englandââ¬â¢s religious and moral as an evil in society. ââ¬Å"By 1850 prostitution had become ââ¬Ëthe Great Social Evil,ââ¬â¢ not simply an affront to morality, but a vital aspect of the social economy as well.â⬠They believed that prostitution was affecting every aspect of society and they urged for the acts to be passed as an attempt to curb the spread of prostitution. Those who wanted the act repealed believed that they infringed on womenââ¬â¢s basic human rights and that they were an attack by the upper class on working class women. Liberal organizations like the Ladies National Association for the Repeal of the C ontagious Diseases Acts, which was led by the prominent feminist Josephine Butler, openly opposed the actions of the English government by protesting and refusing to cooperate with other activist groups. Supporters of the act believed that women who were spreading disease to the future husbands of England shouldShow MoreRelatedSocial Classes, Prostitution and Jack the Ripper in the 19th Century England1227 Words à |à 5 Pages After the Age of Enlightenment in the mid 18th century in England, the tension between the social classes intensified even more. A huge gap generated between the aristocrats and the working class, but dozens of new layers of society appeared. While the rich lived to the fullest, the lower class starved and needed to find alternative ways of money making. Prostitution became more and more widespread, which lead to an inequality and social stratification between poor and rich and due to the economicalRead MoreThe Era Of The Victorian Era1565 Words à |à 7 P agesThe Victorian Era is a period prominent in harboring peace, prosperity as well as introducing the later shifts in industrial and political reforms. Queen Victoria a notable person of the era, began her reign in 1837 and influenced England by the values she encouraged. The Victorian Era is divided into four categories: ââ¬Å"The Early Period is known as ââ¬Å"A time of Troublesâ⬠, The Mid-Victorian Period, The Late Period and The Nineties.â⬠(Stephen Greenblatt). The Nineties is thoroughly separated among theRead MoreVictorian Era: The Start of Corruption in Moral Values1594 Words à |à 7 PagesLasting from 1837 to 1901, the Victorian Era followed the Romantic Era. Starting and ending with the reign of Queen Elizabeth, this time period is now viewed as strict, prudish, and ââ¬Å"old fashioned,â⬠especially in comparison to today. During those times, the people had to follow a certain standard of living; they were upright people that were modest and controlled. Society at the time adhered to rules such as wearing clothes that covered the women head to toe and abiding by the proper etiquette ofRead MoreImages of Victorian Women by the Pre-Raphaelite Brotherhood Essay1012 Words à |à 5 PagesThe Victorian Era was one of great changes in England. Revolutionary movements, such as the Chartist demonstration and the fall of the Second Empire in France, paved the way for new ideologies. The Pre-Raphaelites were inspired by the changing atmosphere of the times and through their art attempted to introduce emotion, realism and originality back into British painting. The members of the Pre-Raphaelite Brotherhood were John Everett Millais, William Holman Hunt, Dante Gabriel Rossetti, F.G. StephensRead MorePro Legalization of Prostitution Essay1151 Words à |à 5 PagesPro Legalization of Prostitution The worldââ¬â¢s largest trade, prostitution, has always found ways to overcome the legal attempts to suppress it. Prostitution has become one of the most common trades throughout the world. Many poor countries have turned to prostitution as an outlet from their economic difficulties. It is the easiest from of labor for those who do not have a proper education or the economic background to join the legal labor force. Many men and women haveRead MoreVictorian Symbolism In Hunts The Awakening840 Words à |à 4 PagesHuntââ¬â¢s ââ¬Å"The Awakeningâ⬠appears to show symbols that make it clear that this is a mistress and her lover. A stereotypical Victorian portrayal of a mistress usually includes pale white skin, brown-reddish and long wavy hair.The absence of a wedding ring, confirming she is not the manââ¬â¢s wife. The mans discarded glove warns that the likely fate of a cast-off mistress was prostitution. Around the room are visible reminders of her kept status (meaning that her lover is paying for some or all of her livingRead MoreWomen s Professions Of Victorian England945 Words à |à 4 PagesDeidre Harris Mrs. Arnett English 1123 19 April 2017 ââ¬Å"Womenââ¬â¢s Professions in Victorian Englandâ⬠A womenââ¬â¢s profession can define her character in society during the Victorian Era. Women are known for strong work ethic. Originally a woman supposed to take care the house hold while the man work. The Victorian society was based off three classes. The Upper Class, Middle Class, and the Working Class. The Upper Class hold the most power because they were given authority, the best living, and controlRead MoreFemale Sexuality Within Charlotte Bronte s Jane Eyre1689 Words à |à 7 PagesEyre sets a strong example of female sexuality in the Victorian era. The title character confronts herself with her feelings for Mr. Rochester and her growing throughout the novel. She eventually finds the courage to embrace herself as she is. Janeââ¬â¢s independent mind and nature contradict the grain of Victorian society. She defies historical notions of female sexuality and Victorian codes and rules on sexuality. Brontà « reimagines the Victorian notion of marriage as she emphasizes Janeà ¢â¬â¢s educationRead MoreThe Regulation Of Prostitution During The Victorian Period1429 Words à |à 6 PagesDuring the Victorian era, women were classified as either being the stay at home mother, or a prostitute. This essay will critically review the statement ââ¬ËThe regulation of prostitution during the Victorian period ââ¬â through the contagious disease acts - symbolised a sexual double standard of morality. One that required different standards of chastity for men and women.ââ¬â¢ This statement will be reviewed by drawing upon contemporary and historical and sexual double standards. The regulation of prostitutionRead MoreThe Public Spheres Of British Victorian Society Essay1470 Words à |à 6 PagesThe public spheres of British Victorian society was a markedly masculine jurisdiction, obviously lacking in a feminine presence. Traditionally the public spheres of the society were considered a manââ¬â¢s domain and women were sequestered into the home, women of t he public were thus considered of ill repute. The modern stay at home woman was considered an extension of her husbandââ¬â¢s wealth, and her being in the home that of how well off the man had become. The rise of the department stores lead to an
Subscribe to:
Comments (Atom)